PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 357aa    MW: 39614.6 Da    PI: 7.4179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1371genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l ++++ +G+g+W+t ++  g+ R++k+c++rw +yl
      Gh_D12G1371 14 KGPWTPEEDLKLTNYIQIHGPGNWRTLPKNAGLERCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_D12G1371  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.458961IPR017930Myb domain
SuperFamilySSF466891.01E-3011108IPR009057Homeodomain-like
SMARTSM007179.6E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001672.56E-111661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.21E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRTPCCDKT GLKKGPWTPE EDLKLTNYIQ IHGPGNWRTL PKNAGLERCG KSCRLRWANY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRNG  120
IDPVTHAPRL DLLDLSSILT STLCNQSLLN ASNLLGAQPL LNPQLLRLAN TLLSLKQENP  180
DILVQYLHKN QLSNSQQHLV PSSLQPSQLQ VQSTIQNDST CTTSTPVPCT SALNQIELMQ  240
NSATGISSNM TSFSCPDTQE PLTSTLTNTC ASLPNYVHWS PNPTDPFTSE NSNVQSVGGS  300
QMFSFDSVRS TPITSPTPLN SPSTFINSSS SVDDKKESFS SLLKFEIPDS LDISDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-30121162105C-Myb DNA-Binding Domain
1msf_C9e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591743e-37AJ459174.1 Gossypium hirsutum partial myb144 gene, clone pGhMYB144.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438147.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D2PVH40.0A0A0D2PVH4_G
STRINGPOPTR_0019s14070.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-89MYB-like 102